PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I00615.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YA
Protein Properties Length: 243aa    MW: 26613.5 Da    PI: 8.6975
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I00615.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA106.91.6e-33138194158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep+YVNaKQy++Il+RRq Rakle+e+kl  ksrkpylheSRh hA++R+Rg+gGrF
  Pahal.I00615.1 138 EEPIYVNAKQYHAILRRRQLRAKLEAENKL-VKSRKPYLHESRHLHAMKRARGTGGRF 194
                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.1E-38136197IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115239.221137197IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.2E-29139194IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.1E-24140162IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860142162IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.1E-24171194IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MLPPHLTENG TIMIQFGHQM PDYDSPATQS TSESHQEVSG MSEGSLNDHN DQSGNHDGYS  60
KSDENKMMSA LSLGNPETAY VHPKTDRSQS FAISYPYADS YYGGAVAAYG QHAIQMHPQL  120
VGMVSSSRVP LPIEPAAEEP IYVNAKQYHA ILRRRQLRAK LEAENKLVKS RKPYLHESRH  180
LHAMKRARGT GGRFLNTKQQ SDSPGGGGTS DAQRMPANGG LFTKHEHNLP PGDRHYHARG  240
GA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-24138204267NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985515.11e-161PREDICTED: nuclear transcription factor Y subunit A-7 isoform X1
SwissprotQ9LVJ71e-44NFYA6_ARATH; Nuclear transcription factor Y subunit A-6
TrEMBLK4AEG21e-159K4AEG2_SETIT; Uncharacterized protein
STRINGSi037269m1e-158(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.13e-42nuclear factor Y, subunit A6